Top Million of Alexa Sites - Page 179

This page will show the Alexa ranking from 178001 to 179000 of whole network websites.

Rank Website Domain WHOIS
# 178001 almega.se WHOIS
# 178002 arbetsgivarguiden.se WHOIS
# 178003 avalanchestudios.com WHOIS
# 178004 bikeid.se WHOIS
# 178005 biljardbolaget.se WHOIS
# 178006 bilskatt.nu WHOIS
# 178007 botkyrka.se WHOIS
# 178008 bring.se WHOIS
# 178009 campinoboras.se WHOIS
# 178010 carnegie.se WHOIS
# 178011 classiccars.se WHOIS
# 178012 cosmoservice.spb.ru WHOIS
# 178013 cylinda.se WHOIS
# 178014 dollarstore.se WHOIS
# 178015 domstol.se WHOIS
# 178016 ecole.kz WHOIS
# 178017 fiskejournalen.se WHOIS
# 178018 flashscore.se WHOIS
# 178019 folkuniversitetet.se WHOIS
# 178020 foodonlineuppsala.se WHOIS
# 178021 forex.se WHOIS
# 178022 funfunfun.se WHOIS
# 178023 gamekeys.se WHOIS
# 178024 gamereactor.se WHOIS
# 178025 gear4music.se WHOIS
# 178026 geilo.no WHOIS
# 178027 gitarren.se WHOIS
# 178028 gyllingproduktion.se WHOIS
# 178029 gymnasium.se WHOIS
# 178030 hakansbilar.se WHOIS
# 178031 hassdesign.com WHOIS
# 178032 hasselbyloppet.se WHOIS
# 178033 icaniwill.se WHOIS
# 178034 kallfelt.se WHOIS
# 178035 kjellberg.se WHOIS
# 178036 laget.se WHOIS
# 178037 legitimeringstjanst.se WHOIS
# 178038 londonportalen.se WHOIS
# 178039 ltu.se WHOIS
# 178040 medinetworks.se WHOIS
# 178041 michaelkors.eu WHOIS
# 178042 modernaforsakringar.se WHOIS
# 178043 modersverige.se WHOIS
# 178044 momsens.se WHOIS
# 178045 mr-eurodisco.com WHOIS
# 178046 mresell.se WHOIS
# 178047 myclub.se WHOIS
# 178048 nordnet.se WHOIS
# 178049 norran.se WHOIS
# 178050 openpowernet.de WHOIS
# 178051 outnorth.se WHOIS
# 178052 pitchers.se WHOIS
# 178053 procivitas.se WHOIS
# 178054 qahani.com WHOIS
# 178055 quanthockey.com WHOIS
# 178056 rapideo.pl WHOIS
# 178057 readycheck.io WHOIS
# 178058 regionostergotland.se WHOIS
# 178059 restaurangmoldau.se WHOIS
# 178060 revistanoticias.sener WHOIS
# 178061 rydsbilglas.se WHOIS
# 178062 skaraborgslanstidning.se WHOIS
# 178063 skovdenyheter.se WHOIS
# 178064 skulldrinker.com WHOIS
# 178065 smartpctools.com WHOIS
# 178066 soderhamnnara.se WHOIS
# 178067 sporttema.se WHOIS
# 178068 streamtajm.pro WHOIS
# 178069 studi.se WHOIS
# 178070 swim-run.se WHOIS
# 178071 teliacompany.com WHOIS
# 178072 tretti.se WHOIS
# 178073 uppsalareturcyklar.se WHOIS
# 178074 value-at-risk.net WHOIS
# 178075 vaxer.stockholm WHOIS
# 178076 veckonr.se WHOIS
# 178077 vgregion.se WHOIS
# 178078 vibilagare.se WHOIS
# 178079 vision.se WHOIS
# 178080 witre.se WHOIS
# 178081 worldwithfairytale.blogspot.com WHOIS
# 178082 yamahacenter.com WHOIS
# 178083 theholidayspot.com WHOIS
# 178084 dominos.com.tr WHOIS
# 178085 nartest.com.tr WHOIS
# 178086 xtool.ru WHOIS
# 178087 nigerianinfopedia.com.ng WHOIS
# 178088 thetiktokacademy.com WHOIS
# 178089 brother.co.jp WHOIS
# 178090 cookiesandyou.com WHOIS
# 178091 frieze.com WHOIS
# 178092 outletinn.com WHOIS
# 178093 pagesuite.com WHOIS
# 178094 radioagricultura.cl WHOIS
# 178095 barracudacentral.org WHOIS
# 178096 idle-empire.com WHOIS
# 178097 platona.net WHOIS
# 178098 worldofmagazine.com WHOIS
# 178099 stylehatch.com WHOIS
# 178100 plantyflix.com WHOIS
# 178101 sexloving.net WHOIS
# 178102 getfreecourses.co WHOIS
# 178103 bilimfili.com WHOIS
# 178104 allconferencealert.com WHOIS
# 178105 board.support WHOIS
# 178106 divan.tv WHOIS
# 178107 businessregistry.gr WHOIS
# 178108 dytikesmaties.gr WHOIS
# 178109 emy.gr WHOIS
# 178110 hyundai.gr WHOIS
# 178111 mikriliga.com WHOIS
# 178112 milfakia.com WHOIS
# 178113 mortoglou.gr WHOIS
# 178114 nafpaktianews.gr WHOIS
# 178115 noa.gr WHOIS
# 178116 odigos-pierias.gr WHOIS
# 178117 oipeirates.tv WHOIS
# 178118 paokmania.gr WHOIS
# 178119 radionw.gr WHOIS
# 178120 scinews.eu WHOIS
# 178121 starkstores.gr WHOIS
# 178122 techingreek.com WHOIS
# 178123 scribblemaps.com WHOIS
# 178124 chronicle.ng WHOIS
# 178125 suitableshelters.com.ng WHOIS
# 178126 tradefree.com.ng WHOIS
# 178127 vnvfoundation.org WHOIS
# 178128 netpaths.net WHOIS
# 178129 gamebirdlabs.com WHOIS
# 178130 myprivateproxy.net WHOIS
# 178131 yassera.myshopify.com WHOIS
# 178132 knjizare-vulkan.rs WHOIS
# 178133 payjunction.com WHOIS
# 178134 fbajans.com WHOIS
# 178135 hintfilmleri.org WHOIS
# 178136 workamajig.com WHOIS
# 178137 dnpedia.com WHOIS
# 178138 data-vykhoda.ru WHOIS
# 178139 hentaigasm.com WHOIS
# 178140 awsubs.co WHOIS
# 178141 otoflik.com WHOIS
# 178142 um-surabaya.ac.id WHOIS
# 178143 untad.ac.id WHOIS
# 178144 cobalt-seadragon-49ga.squarespace.com WHOIS
# 178145 primitivestar.myshopify.com WHOIS
# 178146 selah-family.myshopify.com WHOIS
# 178147 domcomp.com WHOIS
# 178148 divisoup.com WHOIS
# 178149 campaigntr.com WHOIS
# 178150 oldtimemusic.com WHOIS
# 178151 securly.com WHOIS
# 178152 webmii.com WHOIS
# 178153 buenbit.com WHOIS
# 178154 cba.gov.ar WHOIS
# 178155 citytycoon.online WHOIS
# 178156 cordobaeduca.com WHOIS
# 178157 estanciaschiripa.com.ar WHOIS
# 178158 exapuni.com WHOIS
# 178159 iptvparatodos.net WHOIS
# 178160 juegos.net WHOIS
# 178161 lacritica.com.ar WHOIS
# 178162 marchal.com.ar WHOIS
# 178163 meuladopoetico.com WHOIS
# 178164 mosdata.com WHOIS
# 178165 sampietroweb.com.ar WHOIS
# 178166 shaolin.org.cn WHOIS
# 178167 thefreedomfighters.club WHOIS
# 178168 transportescochosa.com WHOIS
# 178169 unju.edu.ar WHOIS
# 178170 unm.edu.ar WHOIS
# 178171 linksofdownloadpcgames88.blogspot.com WHOIS
# 178172 simtonet.com WHOIS
# 178173 asociacionpopular.com.do WHOIS
# 178174 jetpack.com.do WHOIS
# 178175 geticonjar.com WHOIS
# 178176 theteacherscorner.net WHOIS
# 178177 vlichnyj-kabinet.ru WHOIS
# 178178 aig.com WHOIS
# 178179 alituranaturals.com WHOIS
# 178180 andwalsh.com WHOIS
# 178181 khov.com WHOIS
# 178182 mahesh.com WHOIS
# 178183 otis.edu WHOIS
# 178184 nepalitelecom.com WHOIS
# 178185 bestgamingpro.com WHOIS
# 178186 ytmatikvip.com WHOIS
# 178187 blogger.ba WHOIS
# 178188 thestarfishstore.com WHOIS
# 178189 idriesshahfoundation.org WHOIS
# 178190 shoutslogans.com WHOIS
# 178191 fatquartershop.com WHOIS
# 178192 telemetr.io WHOIS
# 178193 tiecenter.ru WHOIS
# 178194 scirra.com WHOIS
# 178195 academyunisur.com.mx WHOIS
# 178196 aforeazteca.com.mx WHOIS
# 178197 agenciammstudio.com WHOIS
# 178198 akky.mx WHOIS
# 178199 allianz.com.mx WHOIS
# 178200 amvo.org.mx WHOIS
# 178201 b2m.com.mx WHOIS
# 178202 bcnslp.edu.mx WHOIS
# 178203 bedsonline.com WHOIS
# 178204 bee-apiary.com WHOIS
# 178205 blog-francia.com WHOIS
# 178206 boldly.com WHOIS
# 178207 capacitamas.com WHOIS
# 178208 cbgrupo.com.mx WHOIS
# 178209 circulomarketingla.com WHOIS
# 178210 cnestadistica.org WHOIS
# 178211 colaboranet.com WHOIS
# 178212 colegiovasconcelos.net WHOIS
# 178213 compressorparts.com WHOIS
# 178214 conexionsilanes.com WHOIS
# 178215 covid19-mx.info WHOIS
# 178216 dev-admin-cargamos.firebaseapp.com WHOIS
# 178217 digitalife.com.mx WHOIS
# 178218 diverza.mx WHOIS
# 178219 drfranciscoramosnarvaez.com WHOIS
# 178220 drmarcosmoralespolanco.com WHOIS
# 178221 e-tlaxcala.mx WHOIS
# 178222 econsciencia.mx WHOIS
# 178223 edomexico.gob.mx WHOIS
# 178224 ekomiapps.de WHOIS
# 178225 elalmanaque.com WHOIS
# 178226 elreto2020.com.mx WHOIS
# 178227 escuelanacionalpcchiapas.mx WHOIS
# 178228 eticket.mx WHOIS
# 178229 factureyapac.com WHOIS
# 178230 femdomtube.xxx WHOIS
# 178231 forebear.store WHOIS
# 178232 gacetaelhalcon.blogspot.com WHOIS
# 178233 gethighered.global WHOIS
# 178234 globalmedia.mx WHOIS
# 178235 goddessseira.com WHOIS
# 178236 habbo.wf WHOIS
# 178237 hacemosweb.com.mx WHOIS
# 178238 hifi-filter.com WHOIS
# 178239 hipocampo.org WHOIS
# 178240 historyanswers.co.uk WHOIS
# 178241 hondalapaz.com.mx WHOIS
# 178242 hotelitowebserver.com WHOIS
# 178243 iberotorreon.mx WHOIS
# 178244 idolpixels.net WHOIS
# 178245 ieschmedicina.org WHOIS
# 178246 inar-allinone.com WHOIS
# 178247 inpolomod.com WHOIS
# 178248 inter-forma.com WHOIS
# 178249 ipade.mx WHOIS
# 178250 irobot.mx WHOIS
# 178251 koehn.com WHOIS
# 178252 kuelga.com WHOIS
# 178253 linskin.com.mx WHOIS
# 178254 lorenasaravia.com WHOIS
# 178255 mccosmetics.mx WHOIS
# 178256 mercyships.org WHOIS
# 178257 mividaenletras.com WHOIS
# 178258 mural.com WHOIS
# 178259 nucleo.pro WHOIS
# 178260 openser.com WHOIS
# 178261 ortofish.com WHOIS
# 178262 parkbeachsystems.com WHOIS
# 178263 patydom.com WHOIS
# 178264 peixe.com.mx WHOIS
# 178265 pelisxd.com WHOIS
# 178266 penjamo.biz WHOIS
# 178267 petroil.mx WHOIS
# 178268 prensalink.com WHOIS
# 178269 printspot.io WHOIS
# 178270 purearoma.co WHOIS
# 178271 red933.mx WHOIS
# 178272 rotary4100.org WHOIS
# 178273 sanluis.gob.mx WHOIS
# 178274 sanluishoy.com.mx WHOIS
# 178275 sax.center WHOIS
# 178276 securityscorecard.io WHOIS
# 178277 segurosatlas.com.mx WHOIS
# 178278 semanariodia7.com WHOIS
# 178279 shoreexcursioneer.com WHOIS
# 178280 socio.gs WHOIS
# 178281 squalodivers.com WHOIS
# 178282 step2-ver-1.myshopify.com WHOIS
# 178283 talkbaja.com WHOIS
# 178284 tec-carbonifera.edu.mx WHOIS
# 178285 textit.in WHOIS
# 178286 tomachangotubanana.com WHOIS
# 178287 totalplayempresarial.com.mx WHOIS
# 178288 travelinn.com.mx WHOIS
# 178289 treyingram.com WHOIS
# 178290 triumphmotorcycles.mx WHOIS
# 178291 uag.mx WHOIS
# 178292 undostres.com.mx WHOIS
# 178293 unedl.edu.mx WHOIS
# 178294 unes.edu.mx WHOIS
# 178295 urlcero.site WHOIS
# 178296 visualizevalue.com WHOIS
# 178297 webmeeting.mx WHOIS
# 178298 whatisemerging.com WHOIS
# 178299 yvesrocher.com.mx WHOIS
# 178300 zendia.mx WHOIS
# 178301 atisport.com WHOIS
# 178302 familykharid.com WHOIS
# 178303 flatsome.ir WHOIS
# 178304 ijtihadnet.ir WHOIS
# 178305 javidsoft.ir WHOIS
# 178306 sazokar.com WHOIS
# 178307 sitedp.com WHOIS
# 178308 vmagz.net WHOIS
# 178309 sunugalinfos.com WHOIS
# 178310 iniciativasnet.com WHOIS
# 178311 smartseohosting.net WHOIS
# 178312 admitad.academy WHOIS
# 178313 agl.com.au WHOIS
# 178314 allbids.com.au WHOIS
# 178315 aussiestrength.com.au WHOIS
# 178316 beaconlighting.com.au WHOIS
# 178317 bicyclesonline.com.au WHOIS
# 178318 digidirect.com.au WHOIS
# 178319 dnrm.qld.gov.au WHOIS
# 178320 neds.com.au WHOIS
# 178321 onepunchmanepisodes.com WHOIS
# 178322 printlocker.com.au WHOIS
# 178323 runway.com.au WHOIS
# 178324 combot.org WHOIS
# 178325 forbescouncils.com WHOIS
# 178326 godfrey-idea.myshopify.com WHOIS
# 178327 kleen-ritecorp.com WHOIS
# 178328 staralliance.com WHOIS
# 178329 tenhundredart.com WHOIS
# 178330 militarybenefits.info WHOIS
# 178331 simplefx.com WHOIS
# 178332 medianewtabsearch.com WHOIS
# 178333 hypable.com WHOIS
# 178334 antikvariat.net WHOIS
# 178335 euromaster.dk WHOIS
# 178336 ewmedico.com WHOIS
# 178337 filmfinder.dk WHOIS
# 178338 indfodsretsprove.dk WHOIS
# 178339 johansf.tech WHOIS
# 178340 pixum.dk WHOIS
# 178341 roedebjarne.dk WHOIS
# 178342 seoghoer.dk WHOIS
# 178343 spreadshirtmedia.net WHOIS
# 178344 cuentoscortos.com WHOIS
# 178345 repeliculashd.com WHOIS
# 178346 tynmagazine.com WHOIS
# 178347 moe.st WHOIS
# 178348 wapedia.mobi WHOIS
# 178349 standartgost.ru WHOIS
# 178350 zofti.com WHOIS
# 178351 dailyreports.info WHOIS
# 178352 a-quiet-place-part-ii-movie-subtitle.over-blog.com WHOIS
# 178353 acumen-resources.com WHOIS
# 178354 adidas.ie WHOIS
# 178355 airsofteire.com WHOIS
# 178356 airsoftguns.ie WHOIS
# 178357 artandcraft.ie WHOIS
# 178358 asil.org WHOIS
# 178359 autoglass.ie WHOIS
# 178360 bardahl.ie WHOIS
# 178361 boots.ie WHOIS
# 178362 browniesanddownies.nl WHOIS
# 178363 carzone.ie WHOIS
# 178364 centerforinquiry.org WHOIS
# 178365 chevrontraining.ie WHOIS
# 178366 cjfallon.ie WHOIS
# 178367 clarelibrary.ie WHOIS
# 178368 connaughttimber.com WHOIS
# 178369 crunchybetty.com WHOIS
# 178370 custompc.ie WHOIS
# 178371 cxc.world WHOIS
# 178372 cysec.gov.cy WHOIS
# 178373 ddlgworld.net WHOIS
# 178374 dediseedbox.com WHOIS
# 178375 diybeautybase.com WHOIS
# 178376 doihaveacase.co.uk WHOIS
# 178377 donegaldaily.com WHOIS
# 178378 drapertools.com WHOIS
# 178379 dsl.sk WHOIS
# 178380 easy-aromatherapy-recipes.com WHOIS
# 178381 ebookamericanpastoralthea.blogcu.com WHOIS
# 178382 ebooks-base.xyz WHOIS
# 178383 eddierockets.ie WHOIS
# 178384 eircom.net WHOIS
# 178385 enovation.ie WHOIS
# 178386 esplora.org.mt WHOIS
# 178387 etnsashbourne.weebly.com WHOIS
# 178388 ezliving-interiors.ie WHOIS
# 178389 filefreak.com WHOIS
# 178390 filmeonlinenoi.biz WHOIS
# 178391 firefliesandmudpies.com WHOIS
# 178392 flipdish.co WHOIS
# 178393 fullthrottlemedia.co.uk WHOIS
# 178394 gaftaums.com WHOIS
# 178395 geohive.ie WHOIS
# 178396 gigable.app WHOIS
# 178397 gillexplore.ie WHOIS
# 178398 glasfarmplanners.ie WHOIS
# 178399 goldenpages.ie WHOIS
# 178400 gps-routes.co.uk WHOIS
# 178401 gtexportal.org WHOIS
# 178402 hbsrecruitmentservices.ie WHOIS
# 178403 heartmindkids.com WHOIS
# 178404 hokkaido.ie WHOIS
# 178405 hpsc.ie WHOIS
# 178406 huion.uk WHOIS
# 178407 icty.org WHOIS
# 178408 iloveclassicrock.com WHOIS
# 178409 incognitostore.ie WHOIS
# 178410 indexfundinvestor.eu WHOIS
# 178411 inmo.ie WHOIS
# 178412 irishstatutebook.ie WHOIS
# 178413 johngrenham.com WHOIS
# 178414 kaggleusercontent.com WHOIS
# 178415 kildare.ie WHOIS
# 178416 landaulaw.co.uk WHOIS
# 178417 laughterandlemonade.com WHOIS
# 178418 libraryireland.com WHOIS
# 178419 literacyworldwide.org WHOIS
# 178420 lwetb-my.sharepoint.com WHOIS
# 178421 macheesmo.com WHOIS
# 178422 maoathome.ie WHOIS
# 178423 mapleholistics.com WHOIS
# 178424 markhansen.co.nz WHOIS
# 178425 marvin.ie WHOIS
# 178426 medleyads.com WHOIS
# 178427 megabikes.ie WHOIS
# 178428 mgexp.com WHOIS
# 178429 micksgarage.com WHOIS
# 178430 msd.eu WHOIS
# 178431 mycit.ie WHOIS
# 178432 myflotracker.com WHOIS
# 178433 myscena.ru WHOIS
# 178434 offalyexpress.ie WHOIS
# 178435 oneessentialcommunity.com WHOIS
# 178436 osi.ie WHOIS
# 178437 osu-pps.com WHOIS
# 178438 pblworks.org WHOIS
# 178439 pcspecialist.ie WHOIS
# 178440 pepgamez.com WHOIS
# 178441 purchase.ie WHOIS
# 178442 radijo.lt WHOIS
# 178443 rasset.ie WHOIS
# 178444 researchcatalogue.net WHOIS
# 178445 rethinkmedia.org WHOIS
# 178446 retrosweat.com.au WHOIS
# 178447 reviewho.com WHOIS
# 178448 robives.com WHOIS
# 178449 sabeo.com WHOIS
# 178450 sandyalexg.com WHOIS
# 178451 skibbereeneagle.ie WHOIS
# 178452 skyscanner.ie WHOIS
# 178453 speedquizzing.com WHOIS
# 178454 superformula.net WHOIS
# 178455 theallpapers.com WHOIS
# 178456 theecologist.org WHOIS
# 178457 thesmartmoneyseries.com WHOIS
# 178458 ticketmaster.ie WHOIS
# 178459 traxco.es WHOIS
# 178460 tvnmovie.net WHOIS
# 178461 uccireland-my.sharepoint.com WHOIS
# 178462 veryspecialtales.com WHOIS
# 178463 vibesandscribes.ie WHOIS
# 178464 voltimum.ie WHOIS
# 178465 vouchercb.com WHOIS
# 178466 wacken.com WHOIS
# 178467 war2.ru WHOIS
# 178468 whatsonstage.com WHOIS
# 178469 wideseanoanchor.com WHOIS
# 178470 wit-hdip-comp-sci-2019.github.io WHOIS
# 178471 xproxxx.com WHOIS
# 178472 zerozeropizza.ie WHOIS
# 178473 alueducation.com WHOIS
# 178474 tehnosila.ru WHOIS
# 178475 termgame.com WHOIS
# 178476 kake.com WHOIS
# 178477 projectfreetv.xyz WHOIS
# 178478 generasia.com WHOIS
# 178479 gtv.com WHOIS
# 178480 wwf.org.uk WHOIS
# 178481 duvely.com WHOIS
# 178482 kickasscracks.com WHOIS
# 178483 bitcoinvigil.com WHOIS
# 178484 shrtfly.com WHOIS
# 178485 alobatis.ir WHOIS
# 178486 sarbook.com WHOIS
# 178487 tag.ir WHOIS
# 178488 coursat.org WHOIS
# 178489 projectcarsgame.com WHOIS
# 178490 presentermedia.com WHOIS
# 178491 campsite.bio WHOIS
# 178492 actividadesdeinfantilyprimaria.com WHOIS
# 178493 andronova.net WHOIS
# 178494 bilgioloji.com WHOIS
# 178495 guncelhdfilm.com WHOIS
# 178496 sinema.to WHOIS
# 178497 lasenza.com WHOIS
# 178498 medal1.com WHOIS
# 178499 mortgagewebsuccess.com WHOIS
# 178500 pianoforall.com WHOIS
# 178501 startupxplore.com WHOIS
# 178502 stopforumspam.com WHOIS
# 178503 adstrant.com WHOIS
# 178504 bmwhk.com WHOIS
# 178505 cantoneseinput.com WHOIS
# 178506 ecfreight.net WHOIS
# 178507 hkbookcity.com WHOIS
# 178508 hkbs.org.hk WHOIS
# 178509 hkcnews.com WHOIS
# 178510 lcsd.gov.hk WHOIS
# 178511 mtr.com.hk WHOIS
# 178512 onlinemarketingplayer.com WHOIS
# 178513 three.com.hk WHOIS
# 178514 toastedbees.com WHOIS
# 178515 twiranking.com WHOIS
# 178516 gdmask.com WHOIS
# 178517 hkie.org.hk WHOIS
# 178518 investous.com WHOIS
# 178519 mr-wu.cn WHOIS
# 178520 ncb.com.hk WHOIS
# 178521 nfpshop.com WHOIS
# 178522 twphcymc.edu.hk WHOIS
# 178523 zwxiaoshuo.com WHOIS
# 178524 idc.com WHOIS
# 178525 steambuy.com WHOIS
# 178526 tecronet.com WHOIS
# 178527 mockuphone.com WHOIS
# 178528 clickandbank.co WHOIS
# 178529 tucuentofavorito.com WHOIS
# 178530 intoguide.com WHOIS
# 178531 abogado.com.ph WHOIS
# 178532 satsis.info WHOIS
# 178533 colorbook.io WHOIS
# 178534 lawrence.com WHOIS
# 178535 techgage.com WHOIS
# 178536 wifirepeater.org WHOIS
# 178537 name-services.com WHOIS
# 178538 bullionnow.com.au WHOIS
# 178539 clipclaps.tv WHOIS
# 178540 theloopywhisk.com WHOIS
# 178541 angelcam.com WHOIS
# 178542 inshot.com WHOIS
# 178543 earthclinic.com WHOIS
# 178544 nis.edu.kz WHOIS
# 178545 fonki.pro WHOIS
# 178546 denizenscript.com WHOIS
# 178547 sovetov.su WHOIS
# 178548 fctables.com WHOIS
# 178549 provesrc.com WHOIS
# 178550 facetec.com WHOIS
# 178551 marketingdive.com WHOIS
# 178552 alchostserver.com WHOIS
# 178553 checkout-x.com WHOIS
# 178554 agrozahyst.com.ua WHOIS
# 178555 ru-geld.de WHOIS
# 178556 administrare.info WHOIS
# 178557 anamariaonisei.ro WHOIS
# 178558 cespun.eu WHOIS
# 178559 deseneleanimate.net WHOIS
# 178560 desprerelatii.net WHOIS
# 178561 diane.ro WHOIS
# 178562 gimnaziu.info WHOIS
# 178563 huff.ro WHOIS
# 178564 newsbuzau.ro WHOIS
# 178565 unibuc.ro WHOIS
# 178566 versuri.ro WHOIS
# 178567 models-resource.com WHOIS
# 178568 bestwifeporn.com WHOIS
# 178569 exofunnels.com WHOIS
# 178570 kartabita.ru WHOIS
# 178571 grimm-all.ru WHOIS
# 178572 akbilisim.com WHOIS
# 178573 lifezeazy.com WHOIS
# 178574 lovequotesmessages.com WHOIS
# 178575 nebojsavukanovic.info WHOIS
# 178576 bestaviation.net WHOIS
# 178577 missedcoupon.com WHOIS
# 178578 vconnect.com WHOIS
# 178579 gdz.chat WHOIS
# 178580 almasport.gr WHOIS
# 178581 amea-care.gr WHOIS
# 178582 businessdaily.gr WHOIS
# 178583 fatsimare.gr WHOIS
# 178584 greekddl.gr WHOIS
# 178585 igamingbusiness.com WHOIS
# 178586 citexco.com WHOIS
# 178587 hamrahansoft.ir WHOIS
# 178588 lemontheme.com WHOIS
# 178589 moltikala.com WHOIS
# 178590 sepehr1fund.com WHOIS
# 178591 visualead.com WHOIS
# 178592 touchblend.com WHOIS
# 178593 adzpago.com WHOIS
# 178594 pharmaprix.ca WHOIS
# 178595 appsiat.com WHOIS
# 178596 bestaliproducts.com WHOIS
# 178597 citemailer.com WHOIS
# 178598 movies4g.com WHOIS
# 178599 downloadgamestorrents.com WHOIS
# 178600 researchleap.com WHOIS
# 178601 bestbuyrdp.com WHOIS
# 178602 skaip.su WHOIS
# 178603 thesweetsetup.com WHOIS
# 178604 mardapp.com WHOIS
# 178605 uzdevumi.lv WHOIS
# 178606 startupbootcamp.org WHOIS
# 178607 geolike.ru WHOIS
# 178608 trackyserver.com WHOIS
# 178609 hibna.ir WHOIS
# 178610 hikvision.center WHOIS
# 178611 shamswebinar.ir WHOIS
# 178612 tmmf.ir WHOIS
# 178613 weberno.com WHOIS
# 178614 boaterexam.com WHOIS
# 178615 it-area-mag.myshopify.com WHOIS
# 178616 jenx67.com WHOIS
# 178617 myfutureplan.me WHOIS
# 178618 cloudmailin.com WHOIS
# 178619 mobtakr.com WHOIS
# 178620 proft.me WHOIS
# 178621 shopmrbeast.com WHOIS
# 178622 helpix.ru WHOIS
# 178623 aporro.com WHOIS
# 178624 kookylovestotravel.com WHOIS
# 178625 listnerds.com WHOIS
# 178626 buytome.com WHOIS
# 178627 gurock.com WHOIS
# 178628 tonna-games.ru WHOIS
# 178629 apkcloud.co WHOIS
# 178630 techulator.com WHOIS
# 178631 matmatch.com WHOIS
# 178632 internet-platform.ru WHOIS
# 178633 top10supps.com WHOIS
# 178634 babymall.com.tr WHOIS
# 178635 drivefire.co WHOIS
# 178636 mfin.gov.rs WHOIS
# 178637 telegraf.tv WHOIS
# 178638 omoloko.ru WHOIS
# 178639 shatura.com WHOIS
# 178640 spbftu.ru WHOIS
# 178641 affluentco.com WHOIS
# 178642 apptha.com WHOIS
# 178643 blogdigy.com WHOIS
# 178644 bobresources.com WHOIS
# 178645 foter.com WHOIS
# 178646 giftcart.com WHOIS
# 178647 hackensackmeridianhealth.org WHOIS
# 178648 hyperlinkcode.com WHOIS
# 178649 indiangaysite.com WHOIS
# 178650 insurancefunda.in WHOIS